PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang01g09960.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 412aa    MW: 45094.5 Da    PI: 5.0891
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang01g09960.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.11.2e-05544639
        zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    C+ +++++   +C+++  +lC +C  + H+       H++
  Vang01g09960.2  5 CDFCGDQRSLVYCRSDAACLCLSCDRNVHSAnalsrrHSR 44
                    *****************************65667777765 PP

2zf-B_box22.62.3e-074689441
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                      C++++++++   C +++  lC++C    H +      H++++
  Vang01g09960.2 46 LLCERCNSQPAFVRCVEDKISLCQNCDWLAHGSsptsstHKRQT 89
                    68*************************99994488888888766 PP

3CCT639e-22354397144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R +a++RYkeK+ktRkFeKk+rY+sRKa+A+ R RvKGrFvk+ 
  Vang01g09960.2 354 RSNAVMRYKEKKKTRKFEKKVRYASRKARADVRRRVKGRFVKAG 397
                     899**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.471147IPR000315B-box-type zinc finger
SMARTSM003366.0E-9447IPR000315B-box-type zinc finger
CDDcd000211.98E-7447No hitNo description
PROSITE profilePS501199.24390IPR000315B-box-type zinc finger
CDDcd000214.07E-54790No hitNo description
SMARTSM003360.124890IPR000315B-box-type zinc finger
PfamPF062032.8E-16354396IPR010402CCT domain
PROSITE profilePS5101715.398354396IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MGYLCDFCGD QRSLVYCRSD AACLCLSCDR NVHSANALSR RHSRSLLCER CNSQPAFVRC  60
VEDKISLCQN CDWLAHGSSP TSSTHKRQTI NCYSGCPSAA EFSSIWSFFL DIPSMGEACE  120
QELGLMSINE NGNKSDLVPP EGTNVSGSSQ VTDLPTKGKF WAGTSSIPVS DSEPRILDQL  180
PEPGNECMPK LNCPGKKISG ICEDDNLYDD FIMDEVDLEL ENYQELFGMA LSHSEELFEN  240
GGIESLFETK DMSASVGESH CHGAVAAEGS STGLVNAIQP ACSNAASVDS MLSTKTEPIV  300
CFTGRQSQSN ISFSGVTKDS AGDYQECDAS SMLLMGEPPW CPPCPESSLH SANRSNAVMR  360
YKEKKKTRKF EKKVRYASRK ARADVRRRVK GRFVKAGDVY DYDPLSQTRS Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505158.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_014505159.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_014505160.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_014505161.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_014505162.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
RefseqXP_014505163.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9SSE51e-147COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A0S3R2P00.0A0A0S3R2P0_PHAAN; Uncharacterized protein
STRINGGLYMA02G38870.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.41e-119CONSTANS-like 9